General Information

  • ID:  hor006449
  • Uniprot ID:  P83962
  • Protein name:  Ventricular natriuretic peptide
  • Gene name:  vnp
  • Organism:  Acipenser transmontanus (White sturgeon)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  Heart atrium and ventricle, and to a very low extent in brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Acipenser (genus), Acipenserini (tribe), Acipenserinae (subfamily), Acipenseridae (family), Acipenseroidei (suborder), Acipenseriformes (order), Chondrostei (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSMNGCFGNRIERIGSWSSLGCNNSRFGSKKRIF
  • Length:  34
  • Propeptide:  MRMGKIAVGYGFLLLLVFQLGVRASTLFNKYNVQELSSLKDLLERLEEKLSPGEESDVYAGSEDLVNDPEEDADLILDNVRKQAEKEFYKPAGFRDENLQRGRLRSIATSARSMNGCFGNRIERIGSWSSLGCNNSRFGSKKRIF
  • Signal peptide:  MRMGKIAVGYGFLLLLVFQLGVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressor activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-22
  • Structure ID:  AF-P83962-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006449_AF2.pdbhor006449_ESM.pdb

Physical Information

Mass: 445517 Formula: C164H262N56O47S3
Absent amino acids: ADHPQTVY Common amino acids: S
pI: 11.96 Basic residues: 7
Polar residues: 17 Hydrophobic residues: 8
Hydrophobicity: -67.35 Boman Index: -9891
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 45.88
Instability Index: 4928.82 Extinction Coefficient cystines: 5625
Absorbance 280nm: 170.45

Literature

  • PubMed ID:  15072558
  • Title:  Four natriuretic peptides (ANP, BNP, VNP and CNP) coexist in the sturgeon: identification of BNP in fish lineage.